Protein Info for HP15_1248 in Marinobacter adhaerens HP15

Annotation: response regulator/TPR domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 PF00072: Response_reg" amino acids 17 to 130 (114 residues), 54.2 bits, see alignment E=9e-18 PF13432: TPR_16" amino acids 213 to 271 (59 residues), 21.5 bits, see alignment 1.7e-07 PF13174: TPR_6" amino acids 239 to 270 (32 residues), 13.2 bits, see alignment (E = 7e-05) PF14559: TPR_19" amino acids 462 to 501 (40 residues), 30 bits, see alignment 3.2e-10

Best Hits

KEGG orthology group: None (inferred from 75% identity to maq:Maqu_0897)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHP7 at UniProt or InterPro

Protein Sequence (545 amino acids)

>HP15_1248 response regulator/TPR domain protein (Marinobacter adhaerens HP15)
MTDTKADVNPFGKLNYLVIDDFENFRLSIRQMLRSCGADTIELVSNASQAIQHCTYNHVD
VVLCDFNLGEGKNGQHILEDLRYKKLLKRSSLFLMVTAETSKEMVMGAREYQPDAYLTKP
INRAVLEKRLGALISQRNTLMPINREIDRENYPEAISLCLQLLPRQPRYKTWLMKTLGDL
YFQLGDLAHALKIYDDVLAQRELSWARLGRCKVLLANRSFDQAVDGLRELIANHPDYMEA
YDLLAEGFERQGRPTQAQQVLEKAIEHSPNALLRQKHLAQLAGSNQDLETSSEAWQRTVE
LGTHSIHDNSEHYLALGQALSDLSEGNLEEEGKEKAREALTVLKKMEKRFEAEEGISLRS
QIVQCRVYAGQGQDKEATKILEKIRPELDNAAALDAATGLDYAKTLFRLGHESDAKALLR
EMSERFSNEPDILQKIESLLDEPVGFRQKIKARTLNRDGIKAFEAGNLQEAVEIFSKALE
IVPDHAALNLNLVQVLMKENDNSPGDAELLKRCQTCLNRLAGLPEQHRQHRRYIALQRKL
KGLMV