Protein Info for PGA1_c12870 in Phaeobacter inhibens DSM 17395

Annotation: putative ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 108 to 131 (24 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 119 to 301 (183 residues), 88 bits, see alignment E=3.4e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 86% identity to sit:TM1040_1495)

Predicted SEED Role

"Pyrimidine ABC transporter, transmembrane component 1" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZU6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PGA1_c12870 putative ABC transporter permease protein (Phaeobacter inhibens DSM 17395)
MKTALAVLSVLAAIAVIWYAACVPMNIKGVLDAAERAGAEVVPATARERRDMGPIGLVAT
NSFAIRDVWSQDRPRLPAPHQVAVELWETTVEKKLTSKRSLIYHGQVTLSATLLGFVIGT
GLGILLAVGIVHSRVMDMSVMPWAIVSQTIPIIALAPMIIVVLYSIGVQGILPKAVISAY
LSFFPVVVGMVKGLRSPDQMQLDLLKTYNASLGQGFWKLRLPASMPYLFASLKIGIAASL
VGAIVGELPTGAVAGLGARLLAGSYYGQTVQIWSALFAAAILAAALVALLGVIERLVLKR
MGVQA