Protein Info for PGA1_c12710 in Phaeobacter inhibens DSM 17395

Annotation: two-component system sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 191 to 218 (28 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 278 to 303 (26 residues), see Phobius details amino acids 325 to 352 (28 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details amino acids 404 to 430 (27 residues), see Phobius details amino acids 438 to 456 (19 residues), see Phobius details amino acids 496 to 516 (21 residues), see Phobius details PF00512: HisKA" amino acids 668 to 734 (67 residues), 68.1 bits, see alignment 5.7e-23 PF02518: HATPase_c" amino acids 780 to 887 (108 residues), 75.1 bits, see alignment E=5.9e-25

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 76% identity to sil:SPO1025)

Predicted SEED Role

"Sensor histidine kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EL69 at UniProt or InterPro

Protein Sequence (892 amino acids)

>PGA1_c12710 two-component system sensor histidine kinase (Phaeobacter inhibens DSM 17395)
MASLNVLALVCLSYVALLFIVAFAADRHASHGRPARWMRSPLIYTLSLSIYCTAWTFYGA
VGYAARSGLEYITIYLGPTLVMVGWWWGLRKLVRIGRSQRITSIADLLSARYGKSNLLAI
GVTILAVIGTTPYISLQLQSITLSFSIFAEADPLRSVNETQTVFWVAAGLAAFAILFGTR
NLNANERHHGVVTAVALEAVVKLVSLLAVGIFVVWGVAGGVGETMARIDASSIGQWQVDG
GRWATITFLSAAAFVCLPRMFQVMVVENEDERHLRVAAWAFPLYLLLISIFVVPIAAIGL
ELLPVGSNPDLFVLTLPLAEGQQGLAMLSFLGGFSSATSMAIVAAMALSTMVSNHIVMPI
WLRWQEVGASVSGDVRHVVLLSRRLSIAGIMALGYFYYTLSGGGAALAAIGLISFTGISQ
MLPSLVGGLFWRGATRSGALAGLSVGFAIWLYTMLLPELGGGLLPAHVLADGVLGLSWLR
PHALFGIEGLDPTVHAVLWSMALNTAAFLIGSLLTFPSPMERLQGAQFVHVFDHSSGPRG
WTGSVAQSEDLMVMSQRILGAGEAQKFFQSELTRQGGRGPLPEPTPAFLERLERELSASI
GAAAAHAMVGQIVGGSSVSVQDLLAVADETAQILEYSNRLETQSEELSRTARKLQETNEK
LTQLSQQKDAFLSQVSHELRTPMTSIRAFSEILRDTENLASQDHSRYAGIIHDEAQRLTR
LLNDLLDLSVLENGQVSLNISAGRLGDVLDHAVATALADGSARLRVERDAATDDMRLSSD
LDRLAQVFINLIANADKYCTAADPQLRITARQSGHWLFIDFIDNGDGIPPAFRTTIFEKF
SRVSPERAGGAGLGLAICREIMQRLGGDVAYLSGEVGGAFQVSLPLRQENPV