Protein Info for Psest_1287 in Pseudomonas stutzeri RCH2

Annotation: GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 11 to 206 (196 residues), 257.6 bits, E=5.2e-81
• PF00117: GATase
  • amino acids 12 to 201 (190 residues), 137.6 bits, E=1.2e-43
• PF07722: Peptidase_C26
  • amino acids 75 to 184 (110 residues), 25.3 bits, E=3.7e-09
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 526 (314 residues), 493.5 bits, E=2.6e-152
• PF02540: NAD_synthase
  • amino acids 216 to 291 (76 residues), 30.2 bits, E=7.5e-11
• PF00958: GMP_synt_C
  • amino acids 434 to 525 (92 residues), 139.5 bits, E=8.8e-45

Best Hits

Swiss-Prot: 92% identical to GUAA_PSEMY: GMP synthase [glutamine-hydrolyzing] (guaA) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to psa:PST_3007)

MetaCyc: 72% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See L0GKC3 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Psest_1287 GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit (Pseudomonas stutzeri RCH2)
MAHPDIHAHRILILDFGSQYTQLIARRVREIGVYCELHPWDMSEDDIRAFAPRGIILAGG
PESVHEEGSPRAPQAVFDLGVPLFGICYGMQTMSEQLGGKVQGSDVREFGYARVDLVGKS
KLFDGIEDHMDDDGVFGLDVWMSHGDKVTEIPAGFHILASTPSCPIAAMGDDVRGYYGVQ
FHPEVTHTRQGGRILSRFILDICGCEALWTPSNIVEDAIAQVRAQVGDANVLLGLSGGVD
SSVVAALLHRAIGDQLTCVFVDNGLLRLHEGDQVMAMFAENMGVKVIRADAEAQFLGNLE
GEADPEKKRKIIGRTFIDVFDAEASKLDNIQFLAQGTIYPDVIESAGAKSGKAHVIKSHH
NVGGLPEEMNLKLVEPLRELFKDEVRKIGLELGLPYDMVYRHPFPGPGLGVRILGEVKKE
YADLLRRADHIFIEELRNFDWYHKTSQAFVVFQPVKSVGVVGDGRRYAWVVALRAVETID
FMTARWAHLPYELLEKVSNRIINEIEGISRVTYDVSSKPPATIEWE