Protein Info for Psest_1284 in Pseudomonas stutzeri RCH2

Annotation: exodeoxyribonuclease VII, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF13742: tRNA_anti_2" amino acids 16 to 108 (93 residues), 103.3 bits, see alignment E=1e-33 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 17 to 360 (344 residues), 431.5 bits, see alignment E=1.7e-133 PF01336: tRNA_anti-codon" amino acids 36 to 110 (75 residues), 53.2 bits, see alignment E=3.5e-18 PF02601: Exonuc_VII_L" amino acids 132 to 443 (312 residues), 375.1 bits, see alignment E=5.3e-116

Best Hits

Swiss-Prot: 96% identical to EX7L_PSEU5: Exodeoxyribonuclease 7 large subunit (xseA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 96% identity to psa:PST_3010)

MetaCyc: 44% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ74 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Psest_1284 exodeoxyribonuclease VII, large subunit (Pseudomonas stutzeri RCH2)
MLKDPFQRLNLDREVLTVSQLNGRARLLLEDVFAQVWVEGEISNLARPASGHIYFTLKDK
NAQVRCALFRQNAARVRQALRDGLAVRVRGKVSLFEGRGDYQLILDTLEPAGDGALRLAF
EALKEKLSAEGLFAAERKAALPAHPRRIGIVSSPTGAVIRDIISVFKRRAPQVELTLIPT
AVQGREATGQIVRALQLADAQGFDALILARGGGSLEDLWCFNEEAVARAVDACVTPIVSA
VGHETDVSIADFVADVRAPTPSAAAELLAPSSADLQHRLSGLQQRLVLRMRDRLHRDAMR
LEGLTRRLRHPGERLQQQAQRIDDLEQRLLRAVDRRLCSGQERLARLETRLAAQHPGRSL
NLLRQRLEHLSSRLPRAMQANLKGRRQQLQSLAQTLNVVSPLATLSRGYSILLDERGQAI
RSASQTQPGQRLKARLGEGELEVRVEDNHLEPVTLPLL