Protein Info for PGA1_c12670 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): D-lactate transporter, substrate binding component
Rationale: Cofit with the other components and important for growth in various D-lactate and D,L-lactate media
Original annotation: ABC-type branched-chain amino acid transport systems, periplasmic component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 44 to 406 (363 residues), 230.7 bits, see alignment E=6.1e-72 PF13433: Peripla_BP_5" amino acids 53 to 408 (356 residues), 58.4 bits, see alignment E=1.1e-19 PF01094: ANF_receptor" amino acids 100 to 364 (265 residues), 26.5 bits, see alignment E=5.1e-10

Best Hits

KEGG orthology group: None (inferred from 85% identity to sit:TM1040_1511)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, periplasmic substrate- binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZT5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PGA1_c12670 D-lactate transporter, substrate binding component (Phaeobacter inhibens DSM 17395)
MSKTDVSRRGVLKTGAIAGAGVALPTIFTASSAAAFTNEPTGSTVTLGFNVPQTGPYADE
GADELRAYQLAVEHLNGGGDGGMMNTFSSKALQGNGIMGKEVKFVTGDTQTKSDAARASA
KSMIEKDGAVMITGGSSSGVAIAVQGLCQEAGVIFMAGLTHSNDTTGKDKKANGFRHFFN
GYMSGAALAPVLKNLYGTDRNAYHLTADYTWGWTQEESIAAATEALGWNTVNKVRTPLAA
TDFSSYIAPVLNSGADVLVLNHYGGNMVNSLTNAVQFGLREKVVNGKNFEIVVPLYSRLM
AKGAGANVKGIHGSTNWHWSLQDEGSQAFVRSFGSKYGFPPSQAAHTVYCQTLLYADAVE
RAGSFNPCAVVEALEGFEFDGLGNGKTLYRAEDHQCFKDVLVVRGKENPTSEFDLLEVVE
VTPAEQVTYAPDHPMFAGGALGTCNSGA