Protein Info for Psest_1283 in Pseudomonas stutzeri RCH2

Annotation: Membrane proteins related to metalloendopeptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF18421: Peptidase_M23_N" amino acids 28 to 96 (69 residues), 87.1 bits, see alignment E=6e-29 PF01551: Peptidase_M23" amino acids 171 to 265 (95 residues), 104 bits, see alignment E=3.9e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_3011)

Predicted SEED Role

"Membrane proteins related to metalloendopeptidases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIL4 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Psest_1283 Membrane proteins related to metalloendopeptidases (Pseudomonas stutzeri RCH2)
MPRVFALLFALAIALPAHAEGFITRLLNKPVPGGVAVIELGNGPSAPQARYQGKPTLVVR
EDGQRWIAIVGIPLSVKPGAQQLEIDGRTQTFQVESRDYRAQHITLNNQRQVNPNPADLK
RIERELDEQNRAYRQFSANQPSNLLFDRPVAGPLSSPFGLRRFFNGEERNPHSGLDFAAK
TGTPIKAPAVGKVILTGDYFFNGKTVFVDHGQGLISMFCHLSEIGVKVGEQLARGQVLGK
VGATGRATGPHLHWNVSLNDARVDPAIFIGAYKP