Protein Info for PGA1_c12660 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): D-lactate transporter, permease component 2
Rationale: Specific phenotype on D-lactate and D,L-lactate and cofit with other components
Original annotation: putative high-affinity branched-chain amino acid transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details amino acids 266 to 295 (30 residues), see Phobius details amino acids 307 to 326 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 323 (316 residues), 118.6 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: None (inferred from 83% identity to sil:SPO1020)

Predicted SEED Role

"Possible ABC transporter subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EL66 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PGA1_c12660 D-lactate transporter, permease component 2 (Phaeobacter inhibens DSM 17395)
MDAILLQILNGLDKGSAYALIALGLTLIFGTLGVVNFAHGALFMIGAFCAVTVQRVLSLS
FETVDETQKDFLGNPLKVKTPYVESWFGPEVGGAIIDWAVPLAILFAIPIMIGVGYVMER
GLIKHFYKRPHADQILVTFGLAIVLQEVVKYFYGANPIQTPAPDALNGVVNLGSIIGMDI
VYPVWRVVYFFFAVVIIGGIFSFLQFTTFGMVVRAGMADRETVGLLGINIDRRFTIMFGI
AAAVAGLAGVMYTPINSPNYHMGMDFLVLSFVVVVVGGMGSLPGAVLAGFLLGVLESFAS
MNEIKSLIPGIDQIIIYVVAIIILLTRPRGLMGRKGVMED