Protein Info for Psest_1281 in Pseudomonas stutzeri RCH2

Annotation: Small-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 180 to 248 (69 residues), 53.2 bits, see alignment E=2.6e-18 PF21082: MS_channel_3rd" amino acids 330 to 391 (62 residues), 25.3 bits, see alignment E=1.7e-09

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_3013)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKJ2 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Psest_1281 Small-conductance mechanosensitive channel (Pseudomonas stutzeri RCH2)
MSDDLAGWLDWLRAHAELQTLLASATLIFAAWLSNWVVKRILVRGLYRLLQHTRENKLQD
FGVIKRLSNIVPALVLSIGVTTVPGLPEAAVTVVQNVCGGFIVLTIALALGAVLDIVNLI
YQRRPDSRLHPIKGYLQVVKIVVYAIATILIIATLIDRSPLILLSGLGAMAAVLMLIFQD
TLLSLVASVQITSNDLIRVGDWVEMPQLNADGDVIDIALHTVKIQNWDKTITSIPTKRFI
SDSFKNWRGMQESGGRRIKRSLYLDQQSVHFLSREECERLHRFNLLDEYLTEKTREIEAW
NAKLEERGKEPVNTRRITNIGSFRAYVERYLRSHGGIHQNMTLIVRQLSPTADGLPLEIY
CFTNTVAWTQYEAIQSDIFDHLLAILPEFGLRVFQHPSGADIRNWGESLMPRGAAVLAAR
EEHSTEDDGEDLPGASQQR