Protein Info for HP15_1220 in Marinobacter adhaerens HP15

Annotation: acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 914 PF02629: CoA_binding" amino acids 12 to 102 (91 residues), 36.8 bits, see alignment E=2.3e-12 PF13380: CoA_binding_2" amino acids 14 to 140 (127 residues), 66.2 bits, see alignment E=1.5e-21 PF13607: Succ_CoA_lig" amino acids 157 to 294 (138 residues), 143.3 bits, see alignment E=1.7e-45 PF19045: Ligase_CoA_2" amino acids 307 to 453 (147 residues), 25.7 bits, see alignment E=4.4e-09 PF13549: ATP-grasp_5" amino acids 483 to 712 (230 residues), 193.9 bits, see alignment E=1e-60 PF13302: Acetyltransf_3" amino acids 740 to 881 (142 residues), 41.6 bits, see alignment E=8e-14 PF00583: Acetyltransf_1" amino acids 774 to 880 (107 residues), 34.8 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: K09181, hypothetical protein (inferred from 90% identity to maq:Maqu_2502)

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHL9 at UniProt or InterPro

Protein Sequence (914 amino acids)

>HP15_1220 acetyltransferase, GNAT family (Marinobacter adhaerens HP15)
MSTRYLESLFNPASIAVIGASERADNLGGMVLRNLMGGGYPGRLLVVNQNDYDNVHGVPC
VKKVSKMEFSPDLAIICTPPDTVAKTIKRLGEAGVRTAIVMTGGMSRTHSKTGQPLMYSV
REAARETGIRVLGPNTIGLMVPARSLNATYAHMGAIPGRVAFVGQSGTIASSVIDWAFAR
GVGFSYFLTLGDGMDIDHDDLIDYLAQDTQTRAILLHIENIPNARRFMSAVRVASRTKPV
IAVKSGRVPESEWFPHDLPDGLKRSDPIYDAMLQRAGVLRVDGLGQMFDALETLTRMRPL
RRETLAIMANGVGPGVLAVDRLADLGGELAELSKSSIENLAELLPPYWTRKNPIDLNYDA
SPELYGQAIKILAKDPEVANVLVMYAPSLTEDSLQIADAVVQASKGTRLNVFTCWLGQST
VMDAREEFYRAGLPSFFNPEKAVMAFMQHVRHQRVQRLLTETPESFTDHFADRTHTRHVV
NRALRAGRYHLSNREARDLVRDYGISTIETMYCDDMEEVLEVFAVERRPIDITIIHEQAC
HPFLDLSPTQRRYKGTVQKLNSEAAIMDSCRYLMEEYKSHFPESGFLGFAVQRSYQHVGG
IEFSVGITRDALFGPLVVCGAAGAQINVMTDRQIALPPLNMVLARELLRRTYMYKLLKEH
SLKPEEDIRAVSETLVTLSQIVIDIPEIKGLEISPLLFNEQGAVAVNIAINLADKPGRPI
IQPYPRELEEWIVLPKSGRRVIIRPVLAEDEPAHRAFHELQSPESIRYRFFQYRKHFSRE
DVAQMVQIDYDREMVFIANAPREDGEGEETLGTVRTWTDADNLQCEFAVMVHDKMKGEGL
GVALMQKMIDYCRARGTVEMVGNVLPDNRPMLQLAEHLGFEIKFNTEEEVMDLRLVLNEP
EKDWQRERLGKIAH