Protein Info for PGA1_c12600 in Phaeobacter inhibens DSM 17395

Annotation: biotin carboxylase AccA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit
  • amino acids 1 to 444 (444 residues), 710.3 bits, E=5.2e-218
• PF00289: Biotin_carb_N
  • amino acids 1 to 110 (110 residues), 155.1 bits, E=2.7e-49
• PF02655: ATP-grasp_3
  • amino acids 114 to 293 (180 residues), 23.9 bits, E=1.2e-08
• PF02786: CPSase_L_D2
  • amino acids 115 to 320 (206 residues), 255.3 bits, E=1.3e-79
• PF02222: ATP-grasp
  • amino acids 139 to 291 (153 residues), 37.3 bits, E=6.9e-13
• PF07478: Dala_Dala_lig_C
  • amino acids 142 to 290 (149 residues), 34.8 bits, E=3.8e-12
• PF02785: Biotin_carb_C
  • amino acids 335 to 440 (106 residues), 121 bits, E=7.6e-39

Best Hits

Swiss-Prot: 62% identical to ACCC_ECOLI: Biotin carboxylase (accC) from Escherichia coli (strain K12)

KEGG orthology group: K01961, acetyl-CoA carboxylase, biotin carboxylase subunit [EC: 6.3.4.14 6.4.1.2] (inferred from 88% identity to sit:TM1040_1518)

MetaCyc: 62% identical to biotin carboxylase (Escherichia coli K-12 substr. MG1655)
Biotin carboxylase. [EC: 6.3.4.14]

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

• biotin-carboxyl carrier protein assembly (4/4 steps found)
• 3-hydroxypropanoate cycle (9/13 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (11/18 steps found)
• glyoxylate assimilation (7/13 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 6.3.4.14 or 6.4.1.2

Sequence Analysis Tools

See I7EW20 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PGA1_c12600 biotin carboxylase AccA (Phaeobacter inhibens DSM 17395)
MFDKILIANRGEIALRVIRACREMGIQSVAVHSTADADAMHVRMADESVCIGPPSGTHSY
LSIPAIISACEITGAQAIHPGYGFLSENANFVQIVEDHGLTFIGPTAEHIRVMGDKITAK
DTMKDLGVPCVPGSDGGVPDLETAKKIGEDIGYPVIIKATAGGGGRGMKVAKTAADMEQA
FMTARAEGKAAFGNDEVYIEKYLTTPRHIEIQVFGDGKGKAVHLGERDCSLQRRHQKVFE
EAPGPCITPEERARIGKTCAEAVAKINYIGAGTIEFLYEKGEFYFIEMNTRLQVEHPVTE
SIFGVDLVREQIRVAEGLPMSFSQDDLEINGHSIEVRINAEKLPNFSPCPGRITQYHAPG
GLGVRMDSALYDGYSIPPYYDSLIGKLIVHGRDRPEALARLSRALGELIVDGVDTTVPLF
HALLEEKDIRTGEYNIHWLEHWLETNLGNA