Protein Info for Psest_1274 in Pseudomonas stutzeri RCH2

Annotation: Endonuclease I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04231: Endonuclease_1" amino acids 24 to 220 (197 residues), 134.7 bits, see alignment E=2.2e-43

Best Hits

Swiss-Prot: 62% identical to DRNE_VIBCH: Extracellular deoxyribonuclease (dns) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01150, deoxyribonuclease I [EC: 3.1.21.1] (inferred from 90% identity to psa:PST_3019)

MetaCyc: 50% identical to DNA-specific endonuclease I (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease I. [EC: 3.1.21.1]

Predicted SEED Role

"Endonuclease I precursor (EC 3.1.21.1)" (EC 3.1.21.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ63 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psest_1274 Endonuclease I (Pseudomonas stutzeri RCH2)
MRRFSFFLLALLVSSSSYADAPRTFREAKKVAWTIYADRPVDFYCGCEFKGNRIDLASCG
YIPRKQPKRAERVEWEHIVPAWVIGHQRQCWQQGGRKHCTANDPVFSRAEADLHNLVPVV
GEVNGDRSNFGFGMLSEKPSQYGACPFVVNFKQRTAMPPEYSRGAIARTYLYMSERYKLR
LSKQDRRLYDIWNRQYPVSEWERWRNQRIACVQGNANDHVGSVDRRSCSKAPSVAAR