Protein Info for Psest_0124 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF00158: Sigma54_activat" amino acids 199 to 366 (168 residues), 238.7 bits, see alignment E=7.2e-75 PF14532: Sigma54_activ_2" amino acids 200 to 370 (171 residues), 76.2 bits, see alignment E=8e-25 PF07728: AAA_5" amino acids 222 to 341 (120 residues), 29.7 bits, see alignment E=1.5e-10 PF25601: AAA_lid_14" amino acids 371 to 450 (80 residues), 71.9 bits, see alignment E=8.2e-24 PF02954: HTH_8" amino acids 458 to 497 (40 residues), 52.9 bits, see alignment 6.1e-18

Best Hits

KEGG orthology group: K11914, sigma-54 dependent transcriptional regulator (inferred from 78% identity to pmy:Pmen_0098)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG46 at UniProt or InterPro

Protein Sequence (505 amino acids)

>Psest_0124 Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains (Pseudomonas stutzeri RCH2)
MSAMFNQVPQPLRYAEALLGRFAGLARAANADSLLGGLVETAAQLSDCQLSQLYLLDATH
TRLTLCAEWHNGLLQPREATSLPSDYDGEQLLQYCLCQNQTLCLSELDSSLHASGFLPDS
PKPWRSLLCLPLQDEQQRVAGLLLTASTESRELHGFSGSLSQLGAFGLTQLHLLQRLRAP
GSTTPPAAPVSPCASGYGLIGDSPRMRAVYQLIGKVLHSPVNVLLTGETGTGKELVARAI
HDCGFRRSKPFVVQNCASLPEQLLESELFGYRKGAFTGADRDRSGLLDAANGGTLFLDEI
GDMPLLLQAKLLRVLQEGEVRPLGSTETHKVDVRIVAATHRDLRSQVENGLFREDLFYRL
SHFPIELPPLRERDEDILRLARHFADKACAFLQRDLCRWSDAALERLAGYAFPGNVRELK
GLVERAVLLCEGGELLPEHLNLHVEASLDSSLNLRERMERVERSLLMDCLRKNGGNQSQA
ARELGLPRRTLLYRMERLNISPADL