Protein Info for PGA1_c12470 in Phaeobacter inhibens DSM 17395

Annotation: sulfite oxidase molybdopterin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 11 to 34 (24 residues), 21 bits, see alignment (E = 3.1e-08) TIGR04555: sulfite dehydrogenase" amino acids 12 to 420 (409 residues), 594.7 bits, see alignment E=9.3e-183 PF00174: Oxidored_molyb" amino acids 114 to 272 (159 residues), 178.4 bits, see alignment E=1.4e-56 PF03404: Mo-co_dimer" amino acids 289 to 408 (120 residues), 75.4 bits, see alignment E=7.1e-25

Best Hits

KEGG orthology group: None (inferred from 87% identity to sil:SPO0998)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZS0 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PGA1_c12470 sulfite oxidase molybdopterin subunit (Phaeobacter inhibens DSM 17395)
MTDKPKQTSPSRRQFLAGAAAIGAGAVTGRPAEAAAPDPLITEVQDWASGLGDGVDATPY
GLPIEHEADVVRRNVEWLTADTISSINFTPIHALDGTITPQGCAFERHHSGAIELRKEDY
RLMINGLVDTPLVFTYADLERFPRENRVYFCECAANSGMEWAGAQLNGAQFTHGMIHNME
YSGVPLRTLLEEAGVNPAGKWVYVEGADASSNGRSIPLEKAMDDVLVAFKANGEALRKEH
GYPVRLVVPGWEGNMWIKWLRRVEVMDQPVESREETSKYTDTLADGTSRKWTWEMDAKSV
VTSPSPQSSIKHGTGPLVITGLAWSGRGAITGVDVSVDGGKSWTEARLAAPGTDKALTRF
YLDTNWDGSEMLLQSRARDASGYVQPTKAQLREVRGLNSIYHNNAIQTWWVKASGEAENV
EVS