Protein Info for PGA1_c01250 in Phaeobacter inhibens DSM 17395

Annotation: electron transfer flavoprotein subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF01012: ETF" amino acids 30 to 210 (181 residues), 144.6 bits, see alignment E=1.5e-46

Best Hits

Swiss-Prot: 81% identical to ETFB_PARDE: Electron transfer flavoprotein subunit beta (etfB) from Paracoccus denitrificans

KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 94% identity to sil:SPO0720)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DL73 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PGA1_c01250 electron transfer flavoprotein subunit beta (Phaeobacter inhibens DSM 17395)
MKVLVPVKRVIDYNVKVRVKADGSGVDLANVKMSMNPFDEIAVEEAIRLKEAGKADEIVV
VSIGVKQAQETLRTALAMGADRAILVNAADDVHTDIEPLAVAKILAKVVEEEQPGLVLAG
KQAIDNDMNATGQMLSALLGWSQGTFASELDVDGDNAVVTREVDGGLQTIKVKMPAIVTV
DLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVDVSPRLEIISTTEPAARAAGIIVGSVD
ELVGKLKEAGAV