Protein Info for Psest_1260 in Pseudomonas stutzeri RCH2

Annotation: type IV pilus biogenesis/stability protein PilW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 8 to 239 (232 residues), 245.6 bits, see alignment E=2.5e-77 PF13432: TPR_16" amino acids 88 to 132 (45 residues), 20.3 bits, see alignment 3.1e-07 amino acids 146 to 190 (45 residues), 19.9 bits, see alignment 4.1e-07 PF13374: TPR_10" amino acids 104 to 132 (29 residues), 15.8 bits, see alignment (E = 5.9e-06) PF13424: TPR_12" amino acids 104 to 169 (66 residues), 37.6 bits, see alignment E=1e-12 PF13181: TPR_8" amino acids 140 to 170 (31 residues), 18.2 bits, see alignment 1.1e-06

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 94% identity to psa:PST_3033)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGE3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Psest_1260 type IV pilus biogenesis/stability protein PilW (Pseudomonas stutzeri RCH2)
MTLRAALLLLLTGLLAGCVSSGTVDPLRTDEGRQQARDAYIQLGIGYLQQGAAARAKTPL
RKALEMDPRSADAHAALALVFQTEMENDLADKHYREALSSRKDARILNNYGSFLFEQKRY
PEAMERFRQAAEDNMYPERARVFQNLGMTALQLGQREEAELHFTRSLRLDGRQPRALLEL
ALMAFEDKQYVPAKRYYDSFSQVAEQNARSLLLGIRLANIHQDRDTAASLGLQLRRLYPG
TDEYKQYLSEQR