Protein Info for PGA1_c12420 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c SoxX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR04485: sulfur oxidation c-type cytochrome SoxX" amino acids 57 to 155 (99 residues), 94.1 bits, see alignment E=3.4e-31 PF00034: Cytochrom_C" amino acids 59 to 156 (98 residues), 42.3 bits, see alignment E=7.8e-15

Best Hits

KEGG orthology group: None (inferred from 71% identity to sil:SPO0993)

MetaCyc: 62% identical to SoxX (Paracoccus pantotrophus)
RXN-11951 [EC: 2.8.5.2]; 2.8.5.2 [EC: 2.8.5.2]

Predicted SEED Role

"Sulfur oxidation protein SoxX" in subsystem Sulfur oxidation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZR4 at UniProt or InterPro

Protein Sequence (158 amino acids)

>PGA1_c12420 cytochrome c SoxX (Phaeobacter inhibens DSM 17395)
MKQISLTLAACLAGTVAFAAEIAPKDVGYDEDGAVAASLSGVAGDAASGALLVGDKSKGN
CVACHQVTALPDVPFHGEIGPALDGAGNRWSEAELRGLVANAKMTFDGTMMPAFYKVDGF
IRPGDAYTGNAGTEPLPPILTAQEIEDVVAFLATLKED