Protein Info for PGA1_c12400 in Phaeobacter inhibens DSM 17395

Annotation: ccdA-like protein SoxV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 55 to 80 (26 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 132 to 159 (28 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details PF02683: DsbD_TM" amino acids 5 to 223 (219 residues), 62.6 bits, see alignment E=3.4e-21 PF13386: DsbD_2" amino acids 9 to 220 (212 residues), 31.4 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: K06196, cytochrome c-type biogenesis protein (inferred from 76% identity to sil:SPO0991)

Predicted SEED Role

"sulfur oxidation V protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW03 at UniProt or InterPro

Protein Sequence (245 amino acids)

>PGA1_c12400 ccdA-like protein SoxV (Phaeobacter inhibens DSM 17395)
MLEISLFGAFVAGLLSFFTPCVLPMVPFYLSYMGGLSMAELRNEGDIAPGAQRRLVLASI
CFAAGVTTVFVLMGMGATALGQLFGQYLDILAYGAAALLLVFGLHFLGVVRIPLLYREAR
VESSASPATFAGAYMMGLAFGFGWTPCVGPALASILMIASGMGDIWRGGLLLLVYGAAMT
APFVIAALFARPFLGFVARHRAAFAWVEKGMGVMLIVFAVLIATGSVRYIAEAMIRWFPA
FASIG