Protein Info for Psest_1252 in Pseudomonas stutzeri RCH2

Annotation: FeS cluster assembly scaffold IscU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01592: NifU_N
  • amino acids 2 to 125 (124 residues), 180.9 bits, E=5.2e-58
• TIGR01999: FeS cluster assembly scaffold IscU
  • amino acids 3 to 125 (123 residues), 225.9 bits, E=5.3e-72

Best Hits

Swiss-Prot: 92% identical to ISCU_AZOVI: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Azotobacter vinelandii

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 99% identity to psa:PST_3041)

MetaCyc: 78% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)

Sequence Analysis Tools

See L0GK88 at UniProt or InterPro

Protein Sequence (128 amino acids)

>Psest_1252 FeS cluster assembly scaffold IscU (Pseudomonas stutzeri RCH2)
MAYSDKVIDHYENPRNVGKFDAEDPSIGTGMVGAPACGDVMRLQIKVNEQGVIEDAKFKT
YGCGSAIASSSLATEWMKGKTLEEAETIKNTQLAEELALPPVKIHCSVLAEDAIKAAVRD
YREKKGLL