Protein Info for PGA1_c12340 in Phaeobacter inhibens DSM 17395

Annotation: Predicted acyl-CoA transferases/carnitine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02515: CoA_transf_3
  • amino acids 17 to 390 (374 residues), 427.3 bits, E=2.7e-132

Best Hits

Swiss-Prot: 37% identical to ACOCT_ECOLI: Acetyl-CoA:oxalate CoA-transferase (yfdE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 73% identity to sit:TM1040_1531)

MetaCyc: 55% identical to acyl-CoA:3-sulfinopropionate CoA-transferase (Variovorax paradoxus)
2.3.1.-

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F"

MetaCyc Pathways

• 3,3'-thiodipropanoate degradation (1/4 steps found)

Sequence Analysis Tools

See I7DPG0 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PGA1_c12340 Predicted acyl-CoA transferases/carnitine dehydratase (Phaeobacter inhibens DSM 17395)
MGSSDPAADGKLPHGPLTGIKVLDLSRILAGPTCTQMLGDLGASVLKVENPQSGGDDTRQ
WGPPYVIDAEGQQSDLSAYFMAANRNKRSVEVDISTVEGQQVIRRLAADADILLENFKPG
GLAKYGLDYDSLHAEFPHLVYGSISGYGQTGPNAQKPGYDLMAQGYGGIMSLTGEPDGRP
MKVGVGIADVMCGMYACVGILAALRYKEQTGEGQQVDIALVDAQIAWLINEGVATLNTGT
APKRRGNEHPSIVPYGLYETSDGHVILAVGNDAQFGRFLSFLGLDGLARDPRFATNPARL
QNRDALADILVPALRQYSTDAVIAAMEARKVPAGPVQTLDQVFATDQIAAREMTIEMTSA
AGPVRLLGNPLKFSRTPVTYRHAPPTCGDSTDLLATAADPFAEESC