Protein Info for PGA1_c12320 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 40 to 56 (17 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 352 to 379 (28 residues), see Phobius details amino acids 394 to 414 (21 residues), see Phobius details PF10129: OpgC_C" amino acids 35 to 415 (381 residues), 356.1 bits, see alignment E=9.6e-111

Best Hits

KEGG orthology group: None (inferred from 73% identity to sit:TM1040_1533)

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZQ5 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PGA1_c12320 Uncharacterized protein conserved in bacteria (Phaeobacter inhibens DSM 17395)
MATISPFPGAKGTETTPVANRPVAPQSDVQPRAPRDPRLDFYRGIAMFIILCAHIPGNRW
TGWIPARFGFSDATEIFVFCSGMASAIAFGGTFGRQGWLMGSARVLFRCWQVFWAHIGLF
VFIATSMAALDLYGSFDKSYIASLNLRPFFENPVPQLVGLMTLSYVPNYFDILPMYLVVL
ALMPLMMGLERIGIWAVAAASIGIWLLANPYMVGLGPDGLSLSAEPWSSREWFFNPFGWQ
LLFFTGFAFMKGWLPAPPVSRVLVVVAASYLVLLAPFGSWKVFLWVEAWNQDLADLIRPT
WKQTAEWREKTDFGLLRFGHFLSLAYLGWVIAGEGGQRLIASGQSTAARIWAVLLSLITK
VGQQSLAVFVFSMALARLLGFAMDLTDRSVLTTAFFNLTGFGLIIGCAYIAAWFKSHPWK
TKR