Protein Info for PGA1_c12300 in Phaeobacter inhibens DSM 17395

Annotation: glucans biosynthesis glucosyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 transmembrane" amino acids 51 to 71 (21 residues), see Phobius details amino acids 87 to 114 (28 residues), see Phobius details amino acids 400 to 423 (24 residues), see Phobius details amino acids 454 to 475 (22 residues), see Phobius details amino acids 488 to 510 (23 residues), see Phobius details amino acids 558 to 586 (29 residues), see Phobius details PF13506: Glyco_transf_21" amino acids 207 to 376 (170 residues), 31.2 bits, see alignment E=1.5e-11 PF13632: Glyco_trans_2_3" amino acids 229 to 453 (225 residues), 54 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 75% identity to sit:TM1040_1535)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVZ2 at UniProt or InterPro

Protein Sequence (636 amino acids)

>PGA1_c12300 glucans biosynthesis glucosyltransferase H (Phaeobacter inhibens DSM 17395)
MTNFSLTPPEQPLAMPEQNFGAHFQDQACPARDDRATTSAPTGEATQGQVALWRVLAFSP
AMAATGLLTWGMKDWFAADGFSMLEVALLVLISFNFFWICFSVSTVLLGLWGLAQRPRAL
GRGRPQRMKVALLMPIYNEVPWYVLGNAQSMLEELHARGGVHDYAMFILSDTRDDAIAAQ
ERASVEALRAMLPVGTQLYYRRRADNAGRKVGNITDWVRRWGAGWDAMLVLDADSLMTGR
AIAHLADALARDPGAGLIQSYPQLIGAQSVFGRMQQFANGVYGLALAEGLARWAGHEGNY
WGHNAIIRTRAFAACAGLPPLRSAFGGEKLIMSHDFVEAGLLRRAGWSVQFLPRIRGSYE
ETPQTLIDHVLRDRRWCQGNLQHLNLLNAKGFRALSRFHLLHGAIGYLMAPVWFALLVIW
ALIGRGEEASVLTYFSETNPLMPSWPDMSEPRHVLVILLIYAMLLAPKLLAVAALPMTGS
RFSEYGGAGPFALSLLVEILLAILYAPILMVQQMIAVLRTTFGLQKGWSPQARDGGRYSW
RTLMKCHALETVSGVALWSGILAGVVSVWLLPIALSLVLAVPLSALSGVPLQRFAKALLA
TREVHKEPRITRIARARRDRLRLALETVPTHRAAAK