Protein Info for PGA1_c12260 in Phaeobacter inhibens DSM 17395

Annotation: monovalent cation/proton antiporter subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 transmembrane" amino acids 6 to 21 (16 residues), see Phobius details amino acids 28 to 50 (23 residues), see Phobius details amino acids 72 to 97 (26 residues), see Phobius details PF00420: Oxidored_q2" amino acids 8 to 105 (98 residues), 65.5 bits, see alignment E=1.5e-22

Best Hits

Swiss-Prot: 40% identical to MRPC_BACSU: Na(+)/H(+) antiporter subunit C (mrpC) from Bacillus subtilis (strain 168)

KEGG orthology group: K05560, multicomponent K+:H+ antiporter subunit C (inferred from 80% identity to sit:TM1040_1539)

Predicted SEED Role

"pH adaptation potassium efflux system c" in subsystem pH adaptation potassium efflux system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EL38 at UniProt or InterPro

Protein Sequence (117 amino acids)

>PGA1_c12260 monovalent cation/proton antiporter subunit C (Phaeobacter inhibens DSM 17395)
MEILVASAVGVLTAAGIYLILRRRSFPVILGLSLVSYAVNVFLFATGRLMTNAPAILNKY
EEVPYTDPLPQALVLTAIVISFGMTAVVVMIALGAYLSSQDDRINLSDDDAKAGDDA