Protein Info for PGA1_c12200 in Phaeobacter inhibens DSM 17395

Annotation: tRNA 2-selenouridine synthase SelU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00581: Rhodanese" amino acids 10 to 127 (118 residues), 37.9 bits, see alignment E=2.1e-13 TIGR03167: tRNA 2-selenouridine synthase" amino acids 17 to 316 (300 residues), 346.3 bits, see alignment E=8.9e-108 PF26341: AAA_SelU" amino acids 142 to 257 (116 residues), 109.9 bits, see alignment E=1.5e-35

Best Hits

KEGG orthology group: K06917, tRNA 2-selenouridine synthase [EC: 2.9.1.-] (inferred from 67% identity to sil:SPO2900)

Predicted SEED Role

"Selenophosphate-dependent tRNA 2-selenouridine synthase" in subsystem Selenocysteine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.9.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVY4 at UniProt or InterPro

Protein Sequence (353 amino acids)

>PGA1_c12200 tRNA 2-selenouridine synthase SelU (Phaeobacter inhibens DSM 17395)
MTIRFTSLSDILDQDYDCVIDVRSPAEFAEDHWPGAINLPVLDNEERAEVGTIYVQESPF
LARKVGAAKVFRNAADHVEQRLSHHPGSWRPLVYCWRGGQRSGSFTWLLQQIGWRADVVE
GGYQSYRRLVNDYLYKTELPHRFVALDGYTGTAKTEILKRVQSLGGQVLDLEGLAHHRGS
LLGDHPTPQPSQKAFESEIAGQLARMTPDQPVLVEAESSKIGARIIPPRLWSGMKRAPRI
AVEASIAARCRYLLAGYDDILSNGDMLRIRLDGLRAHRSNAVVDGWLQLIDAGDKPALTE
ALMVQHYDPAYETARRSIGADVVATLRAGDLGEADLDRLAADLLGELDQLSLG