Protein Info for Psest_1236 in Pseudomonas stutzeri RCH2

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 305 to 326 (22 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 354 (353 residues), 378.6 bits, see alignment E=1.1e-117 PF03739: LptF_LptG" amino acids 5 to 352 (348 residues), 226.9 bits, see alignment E=2e-71

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 98% identity to psa:PST_3057)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK73 at UniProt or InterPro

Protein Sequence (373 amino acids)

>Psest_1236 Predicted permeases (Pseudomonas stutzeri RCH2)
MIVFRYLSRELLVTMSAVSAVLLVIIMSGRFIKYLAQAAQGVLDPGVLLLIMGFRLPGFL
QLILPLGLFLGILLAYGRLYLESEMTVLSATGMSQRRLLAYSMAPAALVAAMVGWLSLGL
APQGIAEVDRILNQQDSLTEFDTLVPGRFQTLRGGSRVTYTRELSADRSELGGVFISETN
VSRQTGKESGLSVLVAESGRQEIQPDGSRYLILENGYRYDGNPGQADYRAIQYDTYGVLL
PKPEVSMELSEREAMPTRELVGSDNVRHQTELQWRLSLPLLVFVVTVLAVPLAKVNPRQG
RFLKLLPAILLYMTYLALLIAVRGALDKGRLPMALGLWWVHGLFLAIGLLMLFWEPIRLR
MSKRRMQREVAHG