Protein Info for PGA1_c12150 in Phaeobacter inhibens DSM 17395

Annotation: dihydroorotate dehydrogenase PyrD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR01036: dihydroorotate dehydrogenase (fumarate)" amino acids 10 to 347 (338 residues), 370.1 bits, see alignment E=4.5e-115 PF01180: DHO_dh" amino acids 44 to 332 (289 residues), 257.9 bits, see alignment E=6e-81

Best Hits

Swiss-Prot: 71% identical to PYRD_RHOS1: Dihydroorotate dehydrogenase (quinone) (pyrD) from Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

KEGG orthology group: K00226, dihydroorotate dehydrogenase (fumarate) [EC: 1.3.98.1] (inferred from 79% identity to sil:SPO2907)

Predicted SEED Role

"Dihydroorotate dehydrogenase (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.98.1

Use Curated BLAST to search for 1.3.3.1 or 1.3.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVX9 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PGA1_c12150 dihydroorotate dehydrogenase PyrD (Phaeobacter inhibens DSM 17395)
MSLTERLALAALHRCDPEAAHGLSIKALKMGLTPTPGPVTSPRLATRIAGLDLPNPVGLA
AGFDKNAEALRPLSQAGFGFIEVGAATPRPQPGNPKPRLFRLTEDQAAINRFGFNNEGMA
VIGQRLAVRPQDAVIGLNLGANKDSGDRAADFAKVLAHCGEHLDFATVNVSSPNTEKLRD
LQGKAALSALLNGVIDTRDGLDRRVPVFLKIAPDLDRAGIEDIAEVAVETGIDAVIATNT
TLKRTGLNSSHRDEAGGLSGAPLFEKSTRVLAQLSELLNGRVPLVGVGGISNAEQAYAKI
CAGASAVQFYTAMVYGGLSLVGDIARGLDDLLARDGHANVADAVASKRGDWL