Protein Info for PGA1_c12060 in Phaeobacter inhibens DSM 17395

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02771: Acyl-CoA_dh_N" amino acids 11 to 122 (112 residues), 111.7 bits, see alignment E=6.4e-36 PF02770: Acyl-CoA_dh_M" amino acids 126 to 222 (97 residues), 86.3 bits, see alignment E=3.3e-28 PF00441: Acyl-CoA_dh_1" amino acids 235 to 383 (149 residues), 151.7 bits, see alignment E=4.4e-48 PF08028: Acyl-CoA_dh_2" amino acids 250 to 372 (123 residues), 41.7 bits, see alignment E=3.6e-14 PF22924: ACOX_C_alpha1" amino acids 321 to 383 (63 residues), 27.1 bits, see alignment E=8.6e-10

Best Hits

Swiss-Prot: 46% identical to ACADL_PIG: Long-chain specific acyl-CoA dehydrogenase, mitochondrial (ACADL) from Sus scrofa

KEGG orthology group: None (inferred from 87% identity to sit:TM1040_1559)

MetaCyc: 46% identical to L-cysteinyl-[NRPS] dehydrogenase (Streptomyces clavuligerus)
RXN-16875

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EL27 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PGA1_c12060 acyl-CoA dehydrogenase (Phaeobacter inhibens DSM 17395)
MSAEQHSSWMTDEHQMLADMTAQFITREWAPKFETWRKQGMMDRSTWNEAGALGLLCPSV
PEEYGGVGGDFGHEAAILIEGSRANLASWGHGIHSGIVAHYVLSYGTEEQKQRWLPKMIT
GELVGALAMTEPSTGSDVQRIKTKAVKDGNAYRLSGQKTFITNGQHANLILVAAKTDPSQ
GSKGISLVAVETDGADGFSRGRNLDKIGLHAADTSELFFDNVEIAPENILGGTEGQGFYQ
MMQQLPQERLIIACGAVGAMEGAVERTITYCKEREAFGGPLTQFQNTRFKLVECQTKTKV
ARAFLDECMVEHLQGKLTVEKAAMAKYWITDTQGDVLDECVQLHGGYGFMQEYAVAEMWT
DARVQRIYGGTNEIMKELIARSL