Protein Info for HP15_1164 in Marinobacter adhaerens HP15

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00500: methionine aminopeptidase, type I
  • amino acids 4 to 251 (248 residues), 349.8 bits, E=4.2e-109
• PF00557: Peptidase_M24
  • amino acids 12 to 242 (231 residues), 195.1 bits, E=6.6e-62

Best Hits

Swiss-Prot: 66% identical to MAP1_ECOL6: Methionine aminopeptidase (map) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 91% identity to maq:Maqu_2549)

MetaCyc: 66% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

• Arg/N-end rule pathway (eukaryotic) (8/14 steps found)
• Ac/N-end rule pathway (6/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

See E4PGZ2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>HP15_1164 methionine aminopeptidase, type I (Marinobacter adhaerens HP15)
MQVSIKTPEEIEKMRVAGRLAAEVLEMIGDHVKPGVSTEELDRICHDYIVNEQKCIPAPL
NYKGFPKSICTSVNHVICHGIPSEKKILKDGDILNIDVTVIKDGYHGDTSKMWIVGKPKP
GTERLIQITQECLYKGIELVKPGTRLGDIGHVIQQHAEKHRYSVVRDYCGHGIGAVFHEE
PQVMHYGKPGTGLELQEGMTFTIEPMINQGKYQTKLLPDGWTVVTKDHKLSAQWEHTILV
TADGHEVLTKRKEESF