Protein Info for PGA1_c11990 in Phaeobacter inhibens DSM 17395

Annotation: acyl-CoA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00501: AMP-binding
  • amino acids 27 to 405 (379 residues), 239.9 bits, E=4.2e-75
• PF13193: AMP-binding_C
  • amino acids 455 to 529 (75 residues), 73 bits, E=3.2e-24

Best Hits

KEGG orthology group: None (inferred from 84% identity to sit:TM1040_1565)

MetaCyc: 47% identical to isovalerate--CoA ligase (Humulus lupulus)
Acetate--CoA ligase. [EC: 6.2.1.1]

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• superpathway of acetate utilization and formation (3/3 steps found)
• acetate and ATP formation from acetyl-CoA III (1/1 steps found)
• acetate conversion to acetyl-CoA (1/1 steps found)
• L-isoleucine biosynthesis V (2/3 steps found)
• ethanol degradation III (2/3 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• chitin deacetylation (2/4 steps found)
• adlupulone and adhumulone biosynthesis (1/6 steps found)
• colupulone and cohumulone biosynthesis (1/6 steps found)
• lupulone and humulone biosynthesis (1/6 steps found)
• cis-geranyl-CoA degradation (2/9 steps found)
• superpathway of bitter acids biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.1

Use Curated BLAST to search for 6.2.1.1

Sequence Analysis Tools

See I7EVW5 at UniProt or InterPro

Protein Sequence (542 amino acids)

>PGA1_c11990 acyl-CoA synthetase (Phaeobacter inhibens DSM 17395)
MGWMSDESGLEKTAANYVPLTPLSHLRRAAHVFADVPAVVYGNHRKTYAAYYDRCTRLAS
ALAGMGVRPGEVVATLIPNLPAQAEAHFGVPACGAVLNTINTRLDVSTVAYIFDHGEAKV
VLVDSQFLTLAEEAKAACDGLGPLIIEVPDDQASYPASGRHPIYEDILAAAAHDFDWIMP
QDEWESLALNYTSGTTGRPKGVVYHHRGAYLMTMGTVISWRMVMQPKYLAIVPLFHCNGW
NHTWMMPVLGGTLICCRDITAPAIYGAIADEGATHFGGAPIVLNMLVNAAEEDRRQFDHT
VEVFTAGAPPAPATLEKIEALGFHVTQVYGLTETYGHVTECLWKGDSWDTLDQQGRAAIK
ARQGVAFPMMDHITVMRDDMQQIAMNGQDQGEIVMRGNSVMKGYLKNPDATAEAFQGGYF
HSGDIAVQHPDGYIQIADRAKDIIISGGENISSVEVEGVLMGHPDVNLAAVVAKPDDKWG
EVPCAFVELKPGATVDPADLIRFARETLAGFKAPKQVVFQELPKTSTGKIQKFELRQQAK
AL