Protein Info for Psest_1215 in Pseudomonas stutzeri RCH2

Annotation: Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 3 to 125 (123 residues), 60.5 bits, E=2.4e-20
• PF13561: adh_short_C2
  • amino acids 9 to 123 (115 residues), 46.1 bits, E=7.4e-16
• PF13460: NAD_binding_10
  • amino acids 9 to 85 (77 residues), 27.5 bits, E=4e-10

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• D-sorbitol degradation II (1/1 steps found)
• superpathway of hexitol degradation (bacteria) (13/18 steps found)
• L-sorbose degradation (1/2 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

See L0GKD5 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Psest_1215 Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) (Pseudomonas stutzeri RCH2)
MQKTVLIVGASRGLGLGLAKQFSSAGWQVIATVRDPQHADTLRQIPQLRVETLDMDDAAS
VDQLAGRLAGTRLDVLFVNAGVAGPQNKPATQATQAEVGQLFYTNAVAPLRLAEQLLPLV
ETDQGFVCDRLNSVPDSRLLPLARPWQPL