Protein Info for Psest_1211 in Pseudomonas stutzeri RCH2

Annotation: xanthine dehydrogenase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02963: xanthine dehydrogenase, small subunit
  • amino acids 2 to 469 (468 residues), 705.5 bits, E=1.4e-216
• PF00111: Fer2
  • amino acids 15 to 71 (57 residues), 31.4 bits, 2.9e-11
• PF01799: Fer2_2
  • amino acids 82 to 156 (75 residues), 91.6 bits, E=5.5e-30
• PF00941: FAD_binding_5
  • amino acids 197 to 360 (164 residues), 180 bits, E=7.2e-57
• PF03450: CO_deh_flav_C
  • amino acids 368 to 468 (101 residues), 120.9 bits, E=4.6e-39

Best Hits

KEGG orthology group: K13481, xanthine dehydrogenase small subunit [EC: 1.17.1.4] (inferred from 92% identity to psa:PST_3081)

Predicted SEED Role

"Xanthine dehydrogenase iron-sulfur subunit (EC 1.17.1.4) / Xanthine dehydrogenase, FAD binding subunit (EC 1.17.1.4)" in subsystem Purine Utilization (EC 1.17.1.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• guanosine nucleotides degradation II (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• ureide biosynthesis (5/7 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• superpathway of purines degradation in plants (11/18 steps found)
• caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
• theophylline degradation (1/9 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.1.4

Use Curated BLAST to search for 1.17.1.4

Sequence Analysis Tools

See L0GK47 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Psest_1211 xanthine dehydrogenase, small subunit (Pseudomonas stutzeri RCH2)
MIQFLLNRELRSERALDPNTTVLQYLREHRGKTGTKEGCASGDCGACTVVVGELVDDRLR
YRTLNSCLTFVSALHGKQLISVEDLKDQGRLHSVQQAMVDCHGSQCGFCTPGFVMSLFAL
QKNAGAVNEYDPHQTHEALAGNLCRCTGYRPILEAAEQACCGKQPDQFDAREAETIAQLK
AIEPRETAELNSGDKRCLSPLTVDDLADIYSANPDARLLAGGTDLALDVTQFHRELPVMI
YVGHIAEMKKVEITDSSIEIGAAAPLTDCYAALAAEYPDFGELLQRFASLQIRNQGTLGG
NIGNASPIGDSPPLLIALGAEVVLRHGASSRALPLEDYFIDYKVTARQPGEFIEKIIVPR
ATSDRLFRAYKVSKRLDDDISAVCAAFDLQITDGVVADARVAFGGMAAIPKRAAACEATL
NGAPWNQQTVEAACEALAEDFTPLTDFRASREYRLLVAQNLLRKCFLEQHAPKTETRVTA
YV