Protein Info for Psest_1203 in Pseudomonas stutzeri RCH2

Annotation: Permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 37 to 56 (20 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details amino acids 430 to 447 (18 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 37 to 410 (374 residues), 170.6 bits, see alignment E=2.3e-54

Best Hits

Swiss-Prot: 51% identical to Y326_METJA: Putative permease MJ0326 (MJ0326) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 98% identity to psa:PST_3090)

MetaCyc: 50% identical to adenine:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-447

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ01 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psest_1203 Permeases (Pseudomonas stutzeri RCH2)
MESIKRKPQAAPLQRTAPVWLDRLFKLSEHRTSIRTELLAGLTTFVTMAYIIFVNPNIMA
DAGIDHGAAFVATCIGAALGCLLMGLYANWPVGLAPGMGLNAFFTYTVVGEMGYSWQIAL
GAVFISGVLFMIMSLSRIREWLLNSIPMSLRFAMGAGVGLFLGLIGLKTAGIVVDSPATL
LTMGSFGEPTALLAAVCFLMIAVLSHRNVFGAILVSMLAVTAIGWAFGLVEYKGLVSMPP
SLAPTWLAMDIAGALNLAMVSVILAFLFVNMFDTAGTLMGVAHRANLVNEDGKIENLSRA
LKADSSSSVVGAFVGCPPVTSYVESASGVAAGGRTGLTAVTVGVLFLIAMFFAPLAGMIP
AYATAGALIYVAMLMMSGLANIDWKDHTDTIPAIVTVVMMPLTFSIANGIALGFLTYATL
KLLTGQRDKVSLSLYVLCVIFIAKFAFL