Protein Info for PGA1_c11820 in Phaeobacter inhibens DSM 17395

Annotation: putative esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF12146: Hydrolase_4" amino acids 13 to 119 (107 residues), 47.4 bits, see alignment E=4.1e-16 PF00561: Abhydrolase_1" amino acids 14 to 239 (226 residues), 81.5 bits, see alignment E=2.1e-26 PF00975: Thioesterase" amino acids 15 to 143 (129 residues), 38 bits, see alignment E=5.5e-13 PF12697: Abhydrolase_6" amino acids 18 to 244 (227 residues), 84.7 bits, see alignment E=3.8e-27

Best Hits

KEGG orthology group: K01175, [EC: 3.1.-.-] (inferred from 70% identity to sit:TM1040_1586)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYB9 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PGA1_c11820 putative esterase (Phaeobacter inhibens DSM 17395)
MLNTIRHGAPTDKPTLMIAHGLYGSARNWGAIAKRLCDDREVIAIDMRNHGNSPWTETHS
YHDMADDLAEVIAAHGGPVDMIGHSMGGKAAMTLALNHPQALRRLLVADIAPVAYQHSQI
QYIHAMRQVDLAKVERRSDAEAQLADLGVEKALQSFFTQSLDLPKKRWRLNLDTLERDMP
HIMGFPETDAQWDGSTLFLSGAASDYVLPEHRPLIKARFSQSHFAKLPDCGHWLHAENPR
AFVATARSFFDA