Protein Info for PGA1_c11790 in Phaeobacter inhibens DSM 17395

Annotation: two-component regulatory system, sensory/regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 842 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 268 to 289 (22 residues), see Phobius details PF03924: CHASE" amino acids 113 to 217 (105 residues), 61.9 bits, see alignment E=1.8e-20 PF08447: PAS_3" amino acids 337 to 420 (84 residues), 43.7 bits, see alignment E=7e-15 PF00512: HisKA" amino acids 461 to 526 (66 residues), 80.2 bits, see alignment 2.4e-26 PF02518: HATPase_c" amino acids 573 to 685 (113 residues), 93.6 bits, see alignment E=2.8e-30 PF00072: Response_reg" amino acids 713 to 822 (110 residues), 89.8 bits, see alignment E=3.4e-29

Best Hits

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVU7 at UniProt or InterPro

Protein Sequence (842 amino acids)

>PGA1_c11790 two-component regulatory system, sensory/regulatory protein (Phaeobacter inhibens DSM 17395)
MRFRPKAWIQALNNRTYLPTLVALVVIIAAGISAESQNDTIYEQKLRADVQYEAGLIRAR
IEGNLAADIQLVRGLQAVLSTEPDMTQRRFSQLAAHLLEAEDSLRNIAAAPDLVIKLMHP
MEGNEAAIGLDYRKNDAQRAAALLARDSGELVLAGPVDLLQGGRGMIARFPIFIGPQGSK
SFWGILSSVIDIDAVYSKGGLTDPDLMIDVALIGKDGKGASGAQFYGNPDILEDSPVLMD
IVLPVGTWQLAARPKEGWPTRADNKWQLRFTILLAGAFILFPTALAGRLSAARRSVIQTL
KRRERELEALSRRLEMAVETSKIGIWEIEDNSDSAIWDHRMRELYGDPVGSSDVPLTVWR
SFLHPNDRDRVINGFQEALRHVRNHSIDFRVRLENGTHKNIRAMGCSFRDSRGRNRMIGV
EWDVTRDVDLNNELKRTNQQLTHRNAQLTYAKQAAEKADQAKTEFLANMSHEIRTPMNGI
IGMSDILAESPLSAEQEQCVDTIRDSSVALLKIINDILDLSRLEAGKMEISTVDFNLRKC
VDGAVDVLRPKLREKGLTFTQTFARELPEQVHGDDGRLRQILVNLLSNAVKFTQYGSVSL
HVSRDVKDPYHLFIDVVDTGIGISEDQARHVFERFSQADAATTRHYGGTGLGLTISNILA
QRMGGGISLNSNEGQGSCFRLEIRLSAARAAPSAPTQISPEAAQLKPGPGVLLLADDNRT
NRLLIRKFLADTPLNVIEAENGREAVDMCRDHQPAIILMDMSMPEVDGLTATRQIRTSNM
AQPAIIALTANAFESDRRACLDAGMDRFLQKPIRKPLLLETIASVQAERAAPPDQTKDGT
NS