Protein Info for Psest_1195 in Pseudomonas stutzeri RCH2

Annotation: xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details amino acids 320 to 342 (23 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 13 to 428 (416 residues), 382 bits, see alignment E=3.6e-118 PF00860: Xan_ur_permease" amino acids 18 to 397 (380 residues), 339.2 bits, see alignment E=1.4e-105 TIGR03173: xanthine permease" amino acids 23 to 430 (408 residues), 513.4 bits, see alignment E=4e-158

Best Hits

Swiss-Prot: 51% identical to UACT_ECOLI: Uric acid transporter UacT (uacT) from Escherichia coli (strain K12)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 81% identity to pfl:PFL_4371)

MetaCyc: 51% identical to urate:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN0-530

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKB4 at UniProt or InterPro

Protein Sequence (446 amino acids)

>Psest_1195 xanthine permease (Pseudomonas stutzeri RCH2)
MNDLNARPAGANRLPWLQQLLVSLQHVLLMYGGAVAVPLIVGQAAGLSRDEIAFLINADL
LVAGIATLVQSLGIGPLGIRMPVMMGASFAAVSSMVVMAGMPGVGMTGIFGATIAAGAFG
LLIAPFVCRIVRFFPPLVTGTVITAIGLSLFPVAVNWAGGGSSTSQFGSVHYLGIAAAVL
GTILLVNRFLRGFWVNVSVLIGMGLGYALAGALGMVDLSGMAAAPAVQVVTPNHFGAPTF
SLAPILSMCLVVVIIFVESAGMFLALGRITGETVDPQRLRRGLLCDAGATFLAGFMNTFT
HSSFAQNIGLVQMTGVRSRYVTAIAGLILIALSLLPKAAFLVASIPAAVLGGAGIAMFGM
VAATGIKILQEADISDRRNQLLVAVSIGLGMIPVIRPEFFAQLPHWLEPITHSGIALATL
SAVALNLLFNVLGGPEREALTGSAHA