Protein Info for HP15_1138 in Marinobacter adhaerens HP15

Annotation: L-carnitine dehydratase/bile acid-inducible protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01796, alpha-methylacyl-CoA racemase [EC: 5.1.99.4] (inferred from 78% identity to maq:Maqu_2037)

Predicted SEED Role

"Alpha-methylacyl-CoA racemase (EC 5.1.99.4)" (EC 5.1.99.4)

MetaCyc Pathways

cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
cholesterol degradation to androstenedione III (anaerobic) (1/22 steps found)
bile acid biosynthesis, neutral pathway (2/29 steps found)
superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

Bile acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGW6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>HP15_1138 L-carnitine dehydratase/bile acid-inducible protein F (Marinobacter adhaerens HP15)
MTEPAVGPVGKTGQHEGNECYSDNSHNKKEIIMAGPLTSLKVLDFSTLLPGPYATMLLAD
MGADVLRVEAPDRVDLTRVMPPHDAGVSTAHGFLNRGKKSLGLNLKEPGSREKVLELVKD
HDIVIEQFRPGVMDRLGIGYEALKAVNPRLIYCSITGYGQTGPYKDRAGHDINYLSLAGV
SSHCGRADSGPPPMGIQIADVAGGSHHAVMGILAAVIHRQQTGEGQFVDISMTDAAFALN
AMAGAACLAGGQEQKPERALLNGGSFYDYYQTRDGRWLSVGSLEPQFASRLFHTLGISEV
TSLAMSQNPEHQQHLKAVLKEKIAEKPLAEWQEIFADEDACVEPVLTISEAAEHPQLKAR
DMVIGVDRGDGTQQPQIGFPIKFEKTPSETSRIGKMLGADNDRFL