Protein Info for Psest_1186 in Pseudomonas stutzeri RCH2

Annotation: heavy metal sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 5 to 448 (444 residues), 445.1 bits, see alignment E=1.6e-137 PF00672: HAMP" amino acids 174 to 227 (54 residues), 33.7 bits, see alignment 5.6e-12 PF00512: HisKA" amino acids 232 to 296 (65 residues), 41.7 bits, see alignment E=1.5e-14 PF02518: HATPase_c" amino acids 340 to 448 (109 residues), 77.1 bits, see alignment E=2.2e-25

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 86% identity to psa:PST_3109)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK19 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Psest_1186 heavy metal sensor kinase (Pseudomonas stutzeri RCH2)
MSLLPRSLSLRLALAFALVASVLLGSIGLYLYRSLEREISWRDDQALLGRLGRMQALLDD
SASIEALRQRPQLYENMLGNRDSLLWLLDAQGRALIEINPARLSIPTLPASAAAELTDTD
GARLAWRRLPGEAGLTLVAGRMLAEREQMLAAYRVKLWWALSLGALLASVLGWLISRRAL
RPVRHLTRQALAIDVQHLHLRLDESAMPSELEPLRGALNQMLNRLEQGFARLSRFSEDLA
HEMRTPLGNLMGQTQQLLHKDRDASAYHALLVSNQEEYERLARMIDSMLFLARAEQPATA
ITRQAFSLPELVEQLCEYFEGVAEERGIQLLDETEGELFGDADLIRRALANLLANALRYG
AGDSPVRIVSGSEDGWRWVSVINQGSPIAAEQLPRLFDRFYRCDPSRAEPGDSGGLGLAI
VRSIMQLHGGEVDVRSDSRQTEFTLRFAATSA