Protein Info for Psest_1178 in Pseudomonas stutzeri RCH2

Updated annotation (from data): D-glycerate 2-kinase (EC 2.7.1.-)
Rationale: Specifically important for: Glycolic Acid. Either glycerate kinase or hydroxypyruvate reductase could be involved in glycolate utilization (via glyoxylate and tartronate-semialdehyde, which can be converted to glycerate, perhaps via hydroxypyruvate). However this protein is similar to TM1585 (also PDB:2b8nA or GCK_THEMA), which is a glycerate kinase. We were not able to find a rationale for KEGG's annotation as hydroxypyruvate reductase. (SEED_correct)
Original annotation: Putative glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13660: DUF4147
  • amino acids 9 to 229 (221 residues), 304.7 bits, E=6.1e-95
• PF05161: MOFRL
  • amino acids 307 to 412 (106 residues), 128.6 bits, E=1.6e-41

Best Hits

Swiss-Prot: 53% identical to TTUD4_AGRVI: Putative hydroxypyruvate reductase (ttuD) from Agrobacterium vitis

KEGG orthology group: K00050, hydroxypyruvate reductase [EC: 1.1.1.81] (inferred from 96% identity to psa:PST_3117)

Predicted SEED Role

"D-glycerate 2-kinase (EC 2.7.1.-)" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism or Entner-Doudoroff Pathway (EC 2.7.1.-)

MetaCyc Pathways

• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• L-serine biosynthesis II (1/4 steps found)
• formaldehyde assimilation I (serine pathway) (5/13 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.81, 2.7.1.-

Use Curated BLAST to search for 1.1.1.81 or 2.7.1.-

Sequence Analysis Tools

See L0GIY0 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Psest_1178 D-glycerate 2-kinase (EC 2.7.1.-) (Pseudomonas stutzeri RCH2)
MTLDPQALLRQLFDSAIEAAHPRHVLADHLPEDRSGRAIVIGAGKAAAAMAEAIEKVWEG
ELSGLVVTRYEHHADCKRIEVVEAAHPVPDDAGERVARRVLELVSNLEESDRVIFLLSGG
GSSLLALPAEGISLADKQAINKALLRSGAHIGEMNCVRKHLSAIKGGRLAKACWPASVYT
YAISDVPGDEATVIASGPTVADPTTSEQALEILERYHIEVPANVRAWLEDPRSETLKPGD
PMLSRSHFRLIATPQQSLDAAAEVARAAGITPLILGDLEGEAREVAKVHAGIARQVVLHG
QPIAAPCVILSGGETTVTVRGNGRGGRNAEFLLALTENLQGLPNVYALAGDTDGIDGSED
NAGALMMPDSYARAETLGLRAADALANNDGYGYFAALDDLIVTGPTRTNVNDFRAILILP
PSA