Protein Info for PGA1_c11580 in Phaeobacter inhibens DSM 17395

Annotation: octopine permease ATP-binding protein P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00005: ABC_tran" amino acids 24 to 181 (158 residues), 110.2 bits, see alignment E=1.3e-35 PF13304: AAA_21" amino acids 141 to 213 (73 residues), 34.7 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 58% identical to OCCP_AGRT4: Octopine permease ATP-binding protein P (occP) from Agrobacterium tumefaciens (strain Ach5)

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 89% identity to sit:TM1040_1711)

Predicted SEED Role

"Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVT1 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PGA1_c11580 octopine permease ATP-binding protein P (Phaeobacter inhibens DSM 17395)
MTDTTPVLEIRGLHKSYGELEVIKGVDITAHRGDVVSLIGSSGSGKSTLLRCCNLLEDSQ
EGDILFKGEPINWSGTGLARRPSDAKQVLRIRTNLSMVFQQFNLWAHMTILQNVMEAPLT
VLGRDRAEVEDAARKYLTKVGIGDKCDAYPAQLSGGQQQRAAIARALCMEPEALLFDEPT
SALDPELEQEVVKVIKDLAAEGRTMIIVTHDMNMAADVSSHIVFLHKGLIEEEGCPDEVF
GSTRSERLRGFLASTRHGK