Protein Info for PGA1_c11560 in Phaeobacter inhibens DSM 17395

Annotation: putative arginine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 142 to 166 (25 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 2 to 222 (221 residues), 60.4 bits, see alignment E=9.8e-21

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 83% identity to rde:RD1_1897)

Predicted SEED Role

"ABC transporter, permease protein, HisMQ family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYA0 at UniProt or InterPro

Protein Sequence (238 amino acids)

>PGA1_c11560 putative arginine transport system permease protein (Phaeobacter inhibens DSM 17395)
MAARAQFAPLSWLGKAYIAVVRGVPDIAFFLFFVIALDQGIEYLRHQVKCPDWDAPVRQG
NDFVVCDIAKMPLSSSDQWIHEVYGFSLAVVTFAIVFGAFAANVLFGAMRAVPRAQIETA
EAYGMTHRQAFWRILVPQMWTYALPGLSNLWMVLIKATPLLFLLGVEDIVYWARELGGSK
TARFTDYPHGDWRMWYFLGLLVFYLAFTKLSEVVLERIRTRLSHGQATLAGEAQRKAS