Protein Info for PGA1_c11550 in Phaeobacter inhibens DSM 17395

Annotation: putative histidine transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 35 to 135 (101 residues), 46.4 bits, see alignment E=2.4e-16 PF00528: BPD_transp_1" amino acids 60 to 248 (189 residues), 64 bits, see alignment E=7.9e-22

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 80% identity to sit:TM1040_1714)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZK1 at UniProt or InterPro

Protein Sequence (268 amino acids)

>PGA1_c11550 putative histidine transport system permease protein (Phaeobacter inhibens DSM 17395)
MSCFQTLQDYGLRSLGLGERMLPRSDFTLCDQFVLIGSGMLWNIYFGAIAVVVGFVIANG
VALAKNSTSTPLRKAAEWFIFIFRGSPLFIQFFFAYFLFLQLKSVSPIFNPLSAAWMGAL
IVLILNTAAYSAEIFYGALRSIPKGDIEAADAYGLSGWPRFRRIMWPTMMRLAWPSYTNE
AIFLFHATTLVFFSGFPAWQQRGDALYYASYFADKTFNPFVPYPILAFYFILLTLVVIGI
FGIINTRLNAHLPQEKRRKIRYRPNLIR