Protein Info for Psest_0114 in Pseudomonas stutzeri RCH2

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 PF07638: Sigma70_ECF" amino acids 20 to 171 (152 residues), 25.3 bits, see alignment E=2.6e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 31 to 183 (153 residues), 66.4 bits, see alignment E=1.2e-22 PF04542: Sigma70_r2" amino acids 38 to 102 (65 residues), 38.5 bits, see alignment E=1.6e-13 PF08281: Sigma70_r4_2" amino acids 130 to 181 (52 residues), 49 bits, see alignment E=7.5e-17 PF04545: Sigma70_r4" amino acids 134 to 181 (48 residues), 32.1 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 53% identical to SIGF_AZOOP: ECF RNA polymerase sigma factor SigF (sigF) from Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 69% identity to pen:PSEEN3272)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG37 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Psest_0114 RNA polymerase sigma factor, sigma-70 family (Pseudomonas stutzeri RCH2)
MERTTSQETLQARENELRALLLRGLDGDARAYRAFLDQLGGHLRGFLRRRLSQSSELEDV
LQEVLLAVHNARQTYRAEQPLTVWVQAICRYKLADHYRARGRQAAQMDWLDEADELLAVQ
DNAQAEACRDLGKLLEQLPPRQRLPIVHVKLEGRSVEETARLTGLSSSAIKVGIHRGLKA
LAAKIRGGA