Protein Info for HP15_114 in Marinobacter adhaerens HP15

Annotation: efflux transporter, RND family, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 96 to 402 (307 residues), 124.7 bits, see alignment E=2e-40 PF16576: HlyD_D23" amino acids 106 to 328 (223 residues), 127.2 bits, see alignment E=8.5e-41 PF13437: HlyD_3" amino acids 227 to 325 (99 residues), 51.6 bits, see alignment E=2.1e-17

Best Hits

KEGG orthology group: None (inferred from 60% identity to amc:MADE_02033)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ59 at UniProt or InterPro

Protein Sequence (415 amino acids)

>HP15_114 efflux transporter, RND family, MFP subunit (Marinobacter adhaerens HP15)
MKKTLISVFVLTLFIAPPSLVQAEEDAHNEAGHDHAAGGDDHREGTGEEDEHEGGHAEER
EHEEEGHGHEEESDGGHEEATSASINAKQKELAGIEVATLESKRVDYEIYAPGELLTNGY
TSYHVSPRVASVVLRRHVELGEHVTKGQPLVTLFSETVAQAQADYRKAFPEWERISGLGR
SVVGDQRFNTAKANIEAARATLLAYGLNDDDIGALKASGVGSLGEYTLRARVDGAVLTDE
FEQGQRVEAGQPLVTLANESELWVEAHLPANSDIVLKQGAEAEVRVAGRVAVATVSQEAH
TIDAVTRTRIVRLELDNPEDRFHPGMFADVYFLFKTKEPVLAVPESALMRGADGDWTVYV
EEAEGEYEPVEVELGRSIGGLREISGLTAGQRIVSRGAFFVASEIAKGGFDPHNH