Protein Info for Psest_1172 in Pseudomonas stutzeri RCH2

Annotation: Stress-induced bacterial acidophilic repeat motif.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 56 PF10685: KGG" amino acids 8 to 28 (21 residues), 39 bits, see alignment E=4.1e-14 amino acids 30 to 50 (21 residues), 42.4 bits, see alignment E=3.4e-15

Best Hits

Swiss-Prot: 66% identical to YMDF_ECOLI: Uncharacterized protein YmdF (ymdF) from Escherichia coli (strain K12)

KEGG orthology group: K06884, (no description) (inferred from 98% identity to psa:PST_3123)

Predicted SEED Role

"Conidiation-specific protein 10"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI88 at UniProt or InterPro

Protein Sequence (56 amino acids)

>Psest_1172 Stress-induced bacterial acidophilic repeat motif. (Pseudomonas stutzeri RCH2)
MANNNPGNFANDKEKASEAGRKGGHNSGGNFANDREKASEAGRKGGQNSHGGGRSS