Protein Info for Psest_1163 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 158 to 182 (25 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 247 to 409 (163 residues), 105.9 bits, see alignment E=9.3e-35 PF00990: GGDEF" amino acids 251 to 407 (157 residues), 131.7 bits, see alignment E=2.1e-42 PF00563: EAL" amino acids 427 to 661 (235 residues), 266.3 bits, see alignment E=2.2e-83

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_3133)

Predicted SEED Role

"GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIW5 at UniProt or InterPro

Protein Sequence (686 amino acids)

>Psest_1163 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MKLEIRNSLSRKLLRVVLLSALAVGLVLSCAQIIFGAYKTRQLIEADAQRILRMTRDPST
QAIYSLDREMGAQVMEGLFQHESIRMASIGHPDEGMLALKIRPPISLPTRWLTDPILGRD
QQFSIPLIGKPPYNEYYGELRITLDTAQYGQEFVNDSVVIFILGLLRALTLGFVLFLIYQ
WLLTRPLTKLIEHLAQINPDRPGEHKLPMIRGHERNELGLWVETANGLLASIEHNMHLRQ
EAESSLHRLTQYDSLTGLPNRQQLQSQLDHILDEARRLQRRIAVLCLGLDDFKGVNEQYS
YQAGDYMLQALADRLRASETRLGALARLGGDQFVLVLSGIEQPYEAAELAQAVLDDLENP
IELDGHPIRLRATIGITLYPEDGDNTEKLLQKAEQTMTLAKSRSRNRYQFYVASIDSEMR
ARRELEKDLSEALKRNEFHLVYQPQVDYRHNRITGVEALIRWKHPQGKLVPPDLFIPLAE
QNGSIIEIGQWVLDQACSQLRQWHAQGHTGLRVAVNLSTVQLRHPQLPAMIGELLHKHQL
PAETLELEVTETGLMEDIDAAANNLHSLRRSGALIAIDDFGTGYSSLSYLKSLPLDKIKI
DKSFVQDIGQDEGATIVRAVIQLGKSLGMTVIAEGVETPAQEAYLIAEGCQEGQGYYYSK
PLPARDLDLLLRQSAPFDRAVNSEFR