Protein Info for Psest_1162 in Pseudomonas stutzeri RCH2

Annotation: Spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF01564: Spermine_synth" amino acids 66 to 181 (116 residues), 28 bits, see alignment E=1.5e-10 PF05430: Methyltransf_30" amino acids 122 to 210 (89 residues), 23.8 bits, see alignment E=3.7e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_3134)

Predicted SEED Role

"FIG00954793: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI79 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Psest_1162 Spermidine synthase (Pseudomonas stutzeri RCH2)
MKRFVLLDTAAIPTGGTLCLFEYGDDFVIKIQGGNGNQLMNTRTHGSEDALAEIPCKRIA
GRPQVRVLIGGLGMGFTLASALRHLGPDAEVLVAELVPGVIEWNHGALGAKSGHPVRDRR
SQVLNQDVAELLQQQPQGFDAIMLDVDNGPEGLTQKSNSWLYSLDGLNACARALRPSGVL
AVWSASADRAFSDKLAKAGFKAEEVQVFAHGNRGTRHTIWIAEKRNR