Protein Info for PGA1_c11400 in Phaeobacter inhibens DSM 17395

Annotation: ferric uptake regulation protein Fur

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF01475: FUR" amino acids 13 to 130 (118 residues), 130.3 bits, see alignment E=2.2e-42

Best Hits

Swiss-Prot: 61% identical to FUR_RHILV: Ferric uptake regulation protein (fur) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K03711, Fur family transcriptional regulator, ferric uptake regulator (inferred from 83% identity to sil:SPO2477)

Predicted SEED Role

"Manganese uptake regulation protein MUR" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZI8 at UniProt or InterPro

Protein Sequence (137 amino acids)

>PGA1_c11400 ferric uptake regulation protein Fur (Phaeobacter inhibens DSM 17395)
MSETIISRCEAIGLRMTGQRRVIARVLQESADHPDVEELYARASALDGAISLATVYRTVK
LFDEAGILERLEFGDGRARYEDADREHHDHLIDMTTGAVIEFCDPEIEALQEKIAEKLGY
ELRGHKLELYGVPRKRD