Protein Info for Psest_1156 in Pseudomonas stutzeri RCH2

Updated annotation (from data): outer membrane component of uptake system, probably for ferrous iron
Rationale: PFam PF07433.7 (DUF1513). In a conserved cofit operon with two efeO-like genes (Psest_1159,Psest_1157) and a efeB-like gene (Psest_1158)
Original annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07433: DUF1513" amino acids 60 to 362 (303 residues), 371.1 bits, see alignment E=1.9e-115

Best Hits

KEGG orthology group: K09947, hypothetical protein (inferred from 90% identity to psa:PST_3140)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJY8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psest_1156 outer membrane component of uptake system, probably for ferrous iron (Pseudomonas stutzeri RCH2)
MRRRTLLGLTGAMFAAGGIAGWTLTRQGDQPVLLSARNDKDGKHYAVGYRLDGSQVFATP
VAERCHDVYPHPYLPLAVFVGRRPSRESYLIDSRDGRLLQVLASPPHRHFYGHGVFHQDG
EWFYTTENDTADAGRGVLGVYRLEDRQLVRVGEHATHGIGPHQLLWMPDNETLVIANGGI
RTEADSRAMMNLDAMEPSLVLLRRDGRLISKEQLPERMNSVRHLAIAADGTIVSGQQYEG
DAMDRVPLLAIKRPGQAFQHFPLGERQRQIMNQYTASLAIHDELRLLAVTAPRGNKVFIW
DLDSTELRQEAHLPDCAGVAAVAEGFVVSSGQGRCRLFDCRGKGIASTPLELPAGLWDNH
LRIV