Protein Info for PGA1_c11350 in Phaeobacter inhibens DSM 17395

Annotation: anhydro-N-acetylmuramic acid kinase AnmK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF03702: AnmK" amino acids 21 to 378 (358 residues), 227.2 bits, see alignment E=1.7e-71

Best Hits

Swiss-Prot: 55% identical to ANMK1_JANSC: Anhydro-N-acetylmuramic acid kinase 1 (anmK1) from Jannaschia sp. (strain CCS1)

KEGG orthology group: K09001, anhydro-N-acetylmuramic acid kinase [EC: 2.7.1.-] (inferred from 59% identity to rcp:RCAP_rcc01712)

Predicted SEED Role

"Anhydro-N-acetylmuramic acid kinase (EC 2.7.1.-)" (EC 2.7.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DZI3 at UniProt or InterPro

Protein Sequence (390 amino acids)

>PGA1_c11350 anhydro-N-acetylmuramic acid kinase AnmK (Phaeobacter inhibens DSM 17395)
MTRSNPSARSSAIPKTGVLRALGTMSGTSLDGVDVAIVETDGVAIHGFGTSAYRAYEPVE
RAQLAAALGQWQGPQVEAAGEIVTRAHAALLAQVLAEDAEAGADQRAVDVIGFHGQTLAH
APRTQGTLQVGDGAALVAELDTPVVWDFRSDDVRLGGEGAPLAPFFHFACAKYLKRDKPL
CFLNLGGVGNLTYVDPRFEAAEDPGALLAFDTGPANAPINDLVQARCGQMMDEGGAIARG
GVVETGALELFLAEPYFARMPPKSLDRNDFAEMITLVSELTDSDATATLTAMCAAAVAQG
MEHCPEPPEVVLVTGGGRHNPVLMEMLRVSLDCPVAPIESVGLDGDMLEAQAFAHLAVRV
ARGMPTSCPGTTGVRACVGGGVVSVPGGED