Protein Info for PGA1_c11340 in Phaeobacter inhibens DSM 17395

Annotation: tyrosyl-tRNA synthetase TyrS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR00234: tyrosine--tRNA ligase" amino acids 15 to 415 (401 residues), 351.5 bits, see alignment E=3.4e-109 PF00579: tRNA-synt_1b" amino acids 38 to 330 (293 residues), 259.9 bits, see alignment E=1.5e-81

Best Hits

Swiss-Prot: 88% identical to SYY_RUEPO: Tyrosine--tRNA ligase (tyrS) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 88% identity to sil:SPO2484)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EKW4 at UniProt or InterPro

Protein Sequence (418 amino acids)

>PGA1_c11340 tyrosyl-tRNA synthetase TyrS (Phaeobacter inhibens DSM 17395)
MTYHPKSDFIAVMMERGYLSDCTDYQGLDEALMTPGQSAYIGFDATATSLHVGSLIQIMM
LRWFQKTGHKPITLMGGGTTKVGDPSFRADERPLLTDAQIDDNIAGIKKVFDAYIDYDSG
AGNAAMMLNNAEWLDDLNYLTFLRDIGRHFSVNRMLSFESVKSRLDREQSLSFLEFNYMI
LQAYDFLELNRRYGCVLQMGGSDQWGNIVNGIDLTRRVLDHEIYGLTSPLLTTSDGKKMG
KSQNGAIWLNGDLLSPYEFWQFWRNTTDADVGRFLKLYTELPVDECNRLGALEGSEVNAA
KVILANEVTTLLHGAEAAAAAEATAREVFEKGGIGDDLPTLALSAADVGDGISIVQLIVK
SGLAKSGKDAKRLIAENGAKIDDQPLTDAGLMIDTAALASPIKLSAGKKRHALVQLDG